Lineage for d4qcfa_ (4qcf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831243Species Bacillus sp. [TaxId:65673] [187690] (11 PDB entries)
  8. 2831258Domain d4qcfa_: 4qcf A: [272943]
    automated match to d2fgla_
    complexed with cl, mg, na; mutant

Details for d4qcfa_

PDB Entry: 4qcf (more details), 2.26 Å

PDB Description: crystal structure of n-terminal mutant (v1a) of an alkali thermostable gh10 xylanase from bacillus sp. ng-27
PDB Compounds: (A:) alkaline thermostable endoxylanase

SCOPe Domain Sequences for d4qcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qcfa_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]}
aqpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

SCOPe Domain Coordinates for d4qcfa_:

Click to download the PDB-style file with coordinates for d4qcfa_.
(The format of our PDB-style files is described here.)

Timeline for d4qcfa_: