Lineage for d4q8va_ (4q8v A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089589Species Zymomonas mobilis [TaxId:542] [51716] (113 PDB entries)
    Uniprot P28720
  8. 2089634Domain d4q8va_: 4q8v A: [272936]
    automated match to d1q2ra_
    protein/RNA complex; complexed with 2yx, gol, zn

Details for d4q8va_

PDB Entry: 4q8v (more details), 1.4 Å

PDB Description: trna-guanine transglycosylase (tgt) in complex with 4-[2-({6-amino-8- oxo-1h,7h,8h-imidazo[4,5-g]quinazolin-2-yl}amino)ethyl]benzonitrile
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d4q8va_:

Sequence, based on SEQRES records: (download)

>d4q8va_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfa

Sequence, based on observed residues (ATOM records): (download)

>d4q8va_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshsrh
mlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqa
enaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpd
dkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkp
ldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqf
aqdfraryfa

SCOPe Domain Coordinates for d4q8va_:

Click to download the PDB-style file with coordinates for d4q8va_.
(The format of our PDB-style files is described here.)

Timeline for d4q8va_: