Lineage for d4q7lc1 (4q7l C:353-593)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129253Species Thermotoga maritima [TaxId:243274] [188915] (5 PDB entries)
  8. 2129262Domain d4q7lc1: 4q7l C:353-593 [272931]
    Other proteins in same PDB: d4q7la2, d4q7la3, d4q7lb2, d4q7lb3, d4q7lc2
    automated match to d1jj7a_
    complexed with ni

Details for d4q7lc1

PDB Entry: 4q7l (more details), 2.35 Å

PDB Description: structure of nbd288 of tm287/288
PDB Compounds: (C:) Uncharacterized ABC transporter ATP-binding protein TM_0288

SCOPe Domain Sequences for d4q7lc1:

Sequence, based on SEQRES records: (download)

>d4q7lc1 c.37.1.0 (C:353-593) automated matches {Thermotoga maritima [TaxId: 243274]}
geiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivnllmrfydvdrgqi
lvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatdeeikeaaklthsdh
fikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeatsnvdtkteksiqa
amwklmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqkrgfyyelftsqyg
l

Sequence, based on observed residues (ATOM records): (download)

>d4q7lc1 c.37.1.0 (C:353-593) automated matches {Thermotoga maritima [TaxId: 243274]}
geiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivnllmrfydvdrgqi
lvdgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatdeeikeaaklthsdh
fikhlpegyetvltdngedlsqgqrqllaitraflanpkilildeatdtkteksiqaamw
klmegktsiiiahrlntiknadliivlrdgeivemgkhdeliqkrgfyyelftsqygl

SCOPe Domain Coordinates for d4q7lc1:

Click to download the PDB-style file with coordinates for d4q7lc1.
(The format of our PDB-style files is described here.)

Timeline for d4q7lc1: