Lineage for d2rtdd_ (2rtd D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674239Domain d2rtdd_: 2rtd D: [27293]
    complexed with btn

Details for d2rtdd_

PDB Entry: 2rtd (more details), 1.65 Å

PDB Description: streptavidin-biotin complex, ph 1.39, space group i222
PDB Compounds: (D:) streptavidin

SCOP Domain Sequences for d2rtdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rtdd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d2rtdd_:

Click to download the PDB-style file with coordinates for d2rtdd_.
(The format of our PDB-style files is described here.)

Timeline for d2rtdd_: