Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [272915] (2 PDB entries) |
Domain d4q47b1: 4q47 B:8-205 [272926] Other proteins in same PDB: d4q47a3, d4q47a4, d4q47b3 automated match to d1oywa2 protein/DNA complex; complexed with adp, zn |
PDB Entry: 4q47 (more details), 2.9 Å
SCOPe Domain Sequences for d4q47b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q47b1 c.37.1.0 (B:8-205) automated matches {Deinococcus radiodurans [TaxId: 243230]} lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert radiksvlrledapqfvs
Timeline for d4q47b1:
View in 3D Domains from other chains: (mouse over for more information) d4q47a1, d4q47a2, d4q47a3, d4q47a4 |