Lineage for d4q47b1 (4q47 B:8-205)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479856Species Deinococcus radiodurans [TaxId:243230] [272915] (2 PDB entries)
  8. 2479863Domain d4q47b1: 4q47 B:8-205 [272926]
    Other proteins in same PDB: d4q47a3, d4q47a4, d4q47b3
    automated match to d1oywa2
    protein/DNA complex; complexed with adp, zn

Details for d4q47b1

PDB Entry: 4q47 (more details), 2.9 Å

PDB Description: structure of the drrecq catalytic core in complex with adp
PDB Compounds: (B:) DNA helicase RecQ

SCOPe Domain Sequences for d4q47b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q47b1 c.37.1.0 (B:8-205) automated matches {Deinococcus radiodurans [TaxId: 243230]}
lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg
ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm
prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert
radiksvlrledapqfvs

SCOPe Domain Coordinates for d4q47b1:

Click to download the PDB-style file with coordinates for d4q47b1.
(The format of our PDB-style files is described here.)

Timeline for d4q47b1: