![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Deinococcus radiodurans [TaxId:243230] [272918] (2 PDB entries) |
![]() | Domain d4q48b3: 4q48 B:408-513 [272925] Other proteins in same PDB: d4q48a1, d4q48a2, d4q48b1, d4q48b2 automated match to d1oywa1 complexed with zn |
PDB Entry: 4q48 (more details), 2.8 Å
SCOPe Domain Sequences for d4q48b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q48b3 a.4.5.0 (B:408-513) automated matches {Deinococcus radiodurans [TaxId: 243230]} prvrdltreaqmalsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehde klwrsvlrqlvslgylsaddhfglratgksrgilkegqklllredt
Timeline for d4q48b3: