SCOPe 2.05: Domain d4q48b1: 4q48 B:8-205

Lineage for d4q48b1 (4q48 B:8-205)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [272915] (2 PDB entries)

8. Domain d4q48b1: 4q48 B:8-205 [272923]
   Other proteins in same PDB: d4q48a3, d4q48b3
   automated match to d1oywa2
   complexed with zn

Details for d4q48b1

PDB Entry: 4q48, 2.8 Å

PDB Description: structure of the recq catalytic core from deinococcus radiodurans

PDB Compounds: (B:) DNA helicase RecQ

SCOPe Domain Sequences for d4q48b1:

Sequence; same for both SEQRES and ATOM records:

>d4q48b1 c.37.1.0 (B:8-205) automated matches {Deinococcus radiodurans [TaxId: 243230]}
lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg
ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm
prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert
radiksvlrledapqfvs

Timeline for d4q48b1:

• d4q48b1 is new in SCOPe 2.05-stable
  
• d4q48b1 appears in SCOPe 2.06
  
• d4q48b1 appears in the current release, SCOPe 2.08