SCOPe 2.07: Domain d4q48a3: 4q48 A:408-512

Lineage for d4q48a3 (4q48 A:408-512)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [272918] (2 PDB entries)

8. Domain d4q48a3: 4q48 A:408-512 [272922]
   Other proteins in same PDB: d4q48a1, d4q48a2, d4q48b1, d4q48b2
   automated match to d1oywa1
   complexed with zn

Details for d4q48a3

PDB Entry: 4q48, 2.8 Å

PDB Description: structure of the recq catalytic core from deinococcus radiodurans

PDB Compounds: (A:) DNA helicase RecQ

SCOPe Domain Sequences for d4q48a3:

Sequence; same for both SEQRES and ATOM records:

>d4q48a3 a.4.5.0 (A:408-512) automated matches {Deinococcus radiodurans [TaxId: 243230]}
prvrdltreaqmalsatirtgnrfgaahltdvllgretdkvlaqghhqlptfgvgkehde
klwrsvlrqlvslgylsaddhfglratgksrgilkegqklllred

Timeline for d4q48a3:

• d4q48a3 first appeared in SCOPe 2.05
  
• d4q48a3 appears in SCOPe 2.06
  
• d4q48a3 appears in the current release, SCOPe 2.08