Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [272915] (2 PDB entries) |
Domain d4q48a1: 4q48 A:8-205 [272920] Other proteins in same PDB: d4q48a3, d4q48b3 automated match to d1oywa2 complexed with zn |
PDB Entry: 4q48 (more details), 2.8 Å
SCOPe Domain Sequences for d4q48a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q48a1 c.37.1.0 (A:8-205) automated matches {Deinococcus radiodurans [TaxId: 243230]} lhdralhllqtiwgypafrgvqgeivqqvaeggnalvlmptgggkslcyqlpsllrpgtg ivvsplialmkdqvdtlrqngvraaflnstllphearevedallrgdldllyvaperllm prtldllerapvalfaideahcvsqwghdfrpeyqqlsvlaerfpelprvaltatadert radiksvlrledapqfvs
Timeline for d4q48a1: