Lineage for d4phlb_ (4phl B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737582Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)
  8. 2737598Domain d4phlb_: 4phl B: [272914]
    automated match to d4i15a_
    complexed with eoh, gai, gol, mg, pil, zn

Details for d4phlb_

PDB Entry: 4phl (more details), 1.95 Å

PDB Description: tbrpdeb1-inhibitor complex
PDB Compounds: (B:) Class 1 phosphodiesterase PDEB1

SCOPe Domain Sequences for d4phlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phlb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
taitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkfg
csdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllita
lvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfggleg
aertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisnv
tkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapff
qkivdaclqgmqwtvdriksnraqwervletr

SCOPe Domain Coordinates for d4phlb_:

Click to download the PDB-style file with coordinates for d4phlb_.
(The format of our PDB-style files is described here.)

Timeline for d4phlb_: