![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) ![]() contains additional, fifth helix at the N-terminus |
![]() | Family a.24.10.0: automated matches [227273] (1 protein) not a true family |
![]() | Protein automated matches [227077] (2 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [234400] (2 PDB entries) |
![]() | Domain d4paca_: 4pac A: [272912] automated match to d4eukb_ complexed with imd, mes |
PDB Entry: 4pac (more details), 2.53 Å
SCOPe Domain Sequences for d4paca_:
Sequence, based on SEQRES records: (download)
>d4paca_ a.24.10.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mefmdaliaqlqrqfrdytislyqqgflddqftelkklqddgspdfvsevlslffedcvk lisnmaraldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvr clqqvdieykalktklqdmfnlekqiiqaggivpqv
>d4paca_ a.24.10.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mefmdaliaqlqrqfrdytislyqqgflddqftelkklqdpdfvsevlslffedcvklis nmaraldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclq qvdieykalktklqdmfnlekqiiqaggivpqv
Timeline for d4paca_: