Lineage for d4paca1 (4pac A:45-197)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700253Family a.24.10.0: automated matches [227273] (1 protein)
    not a true family
  6. 2700254Protein automated matches [227077] (2 species)
    not a true protein
  7. 2700258Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [234400] (2 PDB entries)
  8. 2700260Domain d4paca1: 4pac A:45-197 [272912]
    Other proteins in same PDB: d4paca2
    automated match to d4eukb_
    complexed with imd, mes

Details for d4paca1

PDB Entry: 4pac (more details), 2.53 Å

PDB Description: crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana
PDB Compounds: (A:) Histidine-containing phosphotransfer protein 2

SCOPe Domain Sequences for d4paca1:

Sequence, based on SEQRES records: (download)

>d4paca1 a.24.10.0 (A:45-197) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdaliaqlqrqfrdytislyqqgflddqftelkklqddgspdfvsevlslffedcvklis
nmaraldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclq
qvdieykalktklqdmfnlekqiiqaggivpqv

Sequence, based on observed residues (ATOM records): (download)

>d4paca1 a.24.10.0 (A:45-197) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdaliaqlqrqfrdytislyqqgflddqftelkklqdpdfvsevlslffedcvklisnma
raldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclqqvd
ieykalktklqdmfnlekqiiqaggivpqv

SCOPe Domain Coordinates for d4paca1:

Click to download the PDB-style file with coordinates for d4paca1.
(The format of our PDB-style files is described here.)

Timeline for d4paca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4paca2