SCOPe 2.08: Domain d4paca1: 4pac A:45-197

Lineage for d4paca1 (4pac A:45-197)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.0: automated matches [227273] (1 protein)
   not a true family

6. Protein automated matches [227077] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [234400] (2 PDB entries)

8. Domain d4paca1: 4pac A:45-197 [272912]
   Other proteins in same PDB: d4paca2
   automated match to d4eukb_
   complexed with imd, mes

Details for d4paca1

PDB Entry: 4pac, 2.53 Å

PDB Description: crystal structure of histidine-containing phosphotransfer protein ahp2 from arabidopsis thaliana

PDB Compounds: (A:) Histidine-containing phosphotransfer protein 2

SCOPe Domain Sequences for d4paca1:

Sequence, based on SEQRES records:

>d4paca1 a.24.10.0 (A:45-197) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdaliaqlqrqfrdytislyqqgflddqftelkklqddgspdfvsevlslffedcvklis
nmaraldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclq
qvdieykalktklqdmfnlekqiiqaggivpqv

Sequence, based on observed residues (ATOM records):

>d4paca1 a.24.10.0 (A:45-197) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mdaliaqlqrqfrdytislyqqgflddqftelkklqdpdfvsevlslffedcvklisnma
raldttgtvdfsqvgasvhqlkgssssvgakrvktlcvsfkecceaknyegcvrclqqvd
ieykalktklqdmfnlekqiiqaggivpqv

Timeline for d4paca1:

• d4paca1 first appeared in SCOPe 2.05, called d4paca_
  
• d4paca1 appears in SCOPe 2.07