Lineage for d4p45a1 (4p45 A:55-117,A:351-593)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2127054Family c.56.5.5: FolH catalytic domain-like [53210] (2 protein domains)
  6. 2127055Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
    Folate hydrolase 1, FolH homologue
  7. 2127056Species Human (Homo sapiens) [TaxId:9606] [142523] (24 PDB entries)
    Uniprot Q04609 57-117,351-593
  8. 2127075Domain d4p45a1: 4p45 A:55-117,A:351-593 [272909]
    Other proteins in same PDB: d4p45a2, d4p45a3
    automated match to d2c6ca3
    complexed with 2f9, bma, ca, cl, fuc, man, nag, zn

Details for d4p45a1

PDB Entry: 4p45 (more details), 1.87 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor jrb-4-73
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4p45a1:

Sequence, based on SEQRES records: (download)

>d4p45a1 c.56.5.5 (A:55-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
vllXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlk
kegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdc
tplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffq
rlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfe
lansivl

Sequence, based on observed residues (ATOM records): (download)

>d4p45a1 c.56.5.5 (A:55-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
vllXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlk
kegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdc
tplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffq
rlgiasgrarytknwetgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelans
ivl

SCOPe Domain Coordinates for d4p45a1:

Click to download the PDB-style file with coordinates for d4p45a1.
(The format of our PDB-style files is described here.)

Timeline for d4p45a1: