Lineage for d1swhc_ (1swh C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805917Domain d1swhc_: 1swh C: [27290]
    mutant

Details for d1swhc_

PDB Entry: 1swh (more details), 1.7 Å

PDB Description: core-streptavidin mutant w79f at ph 4.5
PDB Compounds: (C:) core-streptavidin

SCOPe Domain Sequences for d1swhc_:

Sequence, based on SEQRES records: (download)

>d1swhc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvafknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swhc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwtva
fknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1swhc_:

Click to download the PDB-style file with coordinates for d1swhc_.
(The format of our PDB-style files is described here.)

Timeline for d1swhc_: