SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4p4ia3 (4p4i A:594-750)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997956Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1997981Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 1997982Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 protein domains)
  6. 1997983Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 1997984Species Human (Homo sapiens) [TaxId:9606] [140575] (24 PDB entries)
    Uniprot Q04609 594-750
  8. 1998002Domain d4p4ia3: 4p4i A:594-750 [272899]
    Other proteins in same PDB: d4p4ia1, d4p4ia2
    automated match to d2c6ca1
    complexed with 2g5, bma, ca, cl, man, nag, zn

Details for d4p4ia3

PDB Entry: 4p4i (more details), 1.87 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4p4ia3:

Sequence, based on SEQRES records: (download)

>d4p4ia3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d4p4ia3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d4p4ia3:

Click to download the PDB-style file with coordinates for d4p4ia3.
(The format of our PDB-style files is described here.)

Timeline for d4p4ia3: