SCOPe 2.08: Domain d4p4fa1: 4p4f A:55-117,A:351-593

Lineage for d4p4fa1 (4p4f A:55-117,A:351-593)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)

6. Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
   Folate hydrolase 1, FolH homologue

7. Species Human (Homo sapiens) [TaxId:9606] [142523] (34 PDB entries)
   Uniprot Q04609 57-117,351-593

8. Domain d4p4fa1: 4p4f A:55-117,A:351-593 [272891]
   Other proteins in same PDB: d4p4fa2, d4p4fa3
   automated match to d2c6ca3
   complexed with 2gb, ca, cl, nag, zn

Details for d4p4fa1

PDB Entry: 4p4f, 1.86 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor nc-2-40

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4p4fa1:

Sequence; same for both SEQRES and ATOM records:

>d4p4fa1 c.56.5.5 (A:55-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
vllXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlk
kegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdc
tplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffq
rlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfe
lansivl

Timeline for d4p4fa1:

• d4p4fa1 first appeared in SCOPe 2.05
  
• d4p4fa1 appears in SCOPe 2.07