Lineage for d4p4ja3 (4p4j A:594-750)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000364Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2000392Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2000393Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2000394Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 2000395Species Human (Homo sapiens) [TaxId:9606] [140575] (24 PDB entries)
    Uniprot Q04609 594-750
  8. 2000407Domain d4p4ja3: 4p4j A:594-750 [272890]
    Other proteins in same PDB: d4p4ja1, d4p4ja2
    automated match to d2c6ca1
    complexed with 2h9, bma, ca, cl, man, nag, zn

Details for d4p4ja3

PDB Entry: 4p4j (more details), 1.66 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33d
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4p4ja3:

Sequence, based on SEQRES records: (download)

>d4p4ja3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d4p4ja3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d4p4ja3:

Click to download the PDB-style file with coordinates for d4p4ja3.
(The format of our PDB-style files is described here.)

Timeline for d4p4ja3: