Lineage for d4orcb_ (4orc B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2319898Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species)
  7. 2319901Species Human (Homo sapiens) [TaxId:9606] [47532] (8 PDB entries)
  8. 2319907Domain d4orcb_: 4orc B: [272885]
    automated match to d1mf8b_
    complexed with ca, fe, po4, zn

Details for d4orcb_

PDB Entry: 4orc (more details), 2.7 Å

PDB Description: crystal structure of mammalian calcineurin
PDB Compounds: (B:) Calcineurin subunit B type 1

SCOPe Domain Sequences for d4orcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orcb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}
asyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdt
dgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnl
kdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv

SCOPe Domain Coordinates for d4orcb_:

Click to download the PDB-style file with coordinates for d4orcb_.
(The format of our PDB-style files is described here.)

Timeline for d4orcb_: