![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47532] (11 PDB entries) |
![]() | Domain d4orcb_: 4orc B: [272885] automated match to d1mf8b_ complexed with ca, fe, po4, zn |
PDB Entry: 4orc (more details), 2.7 Å
SCOPe Domain Sequences for d4orcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4orcb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} asyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdt dgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnl kdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
Timeline for d4orcb_: