![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcineurin regulatory subunit (B-chain) [47530] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [272883] (1 PDB entry) |
![]() | Domain d4orbb_: 4orb B: [272884] Other proteins in same PDB: d4orba_ automated match to d1tcob_ complexed with ca, fe, zn |
PDB Entry: 4orb (more details), 3.11 Å
SCOPe Domain Sequences for d4orbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4orbb_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Mouse (Mus musculus) [TaxId: 10090]} syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
Timeline for d4orbb_: