Lineage for d4or9a_ (4or9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2232001Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2232112Protein automated matches [190344] (4 species)
    not a true protein
  7. 2232119Species Human (Homo sapiens) [TaxId:9606] [187171] (10 PDB entries)
  8. 2232132Domain d4or9a_: 4or9 A: [272881]
    Other proteins in same PDB: d4or9b_
    automated match to d1auia_
    complexed with ca, fe, zn

Details for d4or9a_

PDB Entry: 4or9 (more details), 2.23 Å

PDB Description: crystal structure of human calcineurin
PDB Compounds: (A:) Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

SCOPe Domain Sequences for d4or9a_:

Sequence, based on SEQRES records: (download)

>d4or9a_ d.159.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppppppgadrvvkavpfppthrltseevfdldgiprvdvlknhlvkegrvdeeialrii
negaailrrektmieveapitvcgdihgqffdlmklfevggspantrylflgdyvdrgyf
siecvlylwvlkilypstlfllrgnhecrhlteyftfkqeckikyservyeacmeafdsl
plaallnqqflcvhgglspeihtlddirrldrfkeppafgpmcdllwsdpsedfgneksq
ehfshntvrgcsyfynypavceflqnnnllsiiraheaqdagyrmyrksqttgfpsliti
fsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvteml
vnvlsicsddelmtegedqfdgsaaarkeiirnkiraigkmarvfsvlreesesvltlkg
ltptgmlpsgvlaggrqtlqsatveaieaekairgfspphricsfeeakgldrinermpp
r

Sequence, based on observed residues (ATOM records): (download)

>d4or9a_ d.159.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppppppgadrvvkavpfppthrltseevfdldgiprvdvlknhlvkegrvdeeialrii
negaailrrektmieveapitvcgdihgqffdlmklfevggspantrylflgdyvdrgyf
siecvlylwvlkilypstlfllrgnhecrhlteyftfkqeckikyservyeacmeafdsl
plaallnqqflcvhgglspeihtlddirrldrfkeppafgpmcdllwsdpsedfgneksq
ehfshntvrgcsyfynypavceflqnnnllsiiraheaqdagyrmyrksqttgfpsliti
fsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvteml
vnvlsicsddelmarvfsvlrsfeeakgldrinermppr

SCOPe Domain Coordinates for d4or9a_:

Click to download the PDB-style file with coordinates for d4or9a_.
(The format of our PDB-style files is described here.)

Timeline for d4or9a_: