SCOPe 2.05: Domain d4d6aa_: 4d6a A:

Lineage for d4d6aa_ (4d6a A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (24 PDB entries)

8. Domain d4d6aa_: 4d6a A: [272859]
   automated match to d4bvma_
   complexed with cit, plm

Details for d4d6aa_

PDB Entry: 4d6a, 1.45 Å

PDB Description: human myelin protein p2 after neutron scattering experiments

PDB Compounds: (A:) myelin p2 protein

SCOPe Domain Sequences for d4d6aa_:

Sequence; same for both SEQRES and ATOM records:

>d4d6aa_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmsnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfk
nteisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeck
mkgvvctriyekv

Timeline for d4d6aa_:

• d4d6aa_ is new in SCOPe 2.05-stable
  
• d4d6aa_ is called d4d6aa1 in SCOPe 2.06
  
• d4d6aa_ appears in the current release, SCOPe 2.08, called d4d6aa1