SCOPe 2.06: Domain d4cx8a_: 4cx8 A:

Lineage for d4cx8a_ (4cx8 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
   core: barrel, closed; n=7, S=8; complex topology

4. Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families)
   automatically mapped to Pfam PF00716

5. Family b.57.1.0: automated matches [272851] (1 protein)
   not a true family

6. Protein automated matches [272852] (1 species)
   not a true protein

7. Species Suid herpesvirus 1 [TaxId:10345] [272856] (4 PDB entries)

8. Domain d4cx8a_: 4cx8 A: [272858]
   automated match to d1at3a_

Details for d4cx8a_

PDB Entry: 4cx8, 2.53 Å

PDB Description: monomeric pseudorabies virus protease pul26n at 2.5 a resolution

PDB Compounds: (A:) pseudorabies virus protease

SCOPe Domain Sequences for d4cx8a_:

Sequence, based on SEQRES records:

>d4cx8a_ b.57.1.0 (A:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}
gpvyvsgylalydrdggelaltreivaaalppagplpinidhrprcdigavlavvdddrg
pfflgvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgeap
detlfahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervwh
mseealtrallstavnnmllrdrwelvaarrreagvrghtylq

Sequence, based on observed residues (ATOM records):

>d4cx8a_ b.57.1.0 (A:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}
gpvyvsgylalydraltreivaaalppagplpinidhrprcdigavlavvdddrgpfflg
vvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgeapdetlf
ahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervwhmseea
ltrallmllrdrwelvaarrreagvrghtylq

Timeline for d4cx8a_:

• d4cx8a_ first appeared in SCOPe 2.05
  
• d4cx8a_ appears in SCOPe 2.07
  
• d4cx8a_ appears in the current release, SCOPe 2.08