SCOP 1.73: Domain d2rtrd_: 2rtr D:

Lineage for d2rtrd_ (2rtr D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d2rtrd_: 2rtr D: [27285]
   complexed with imi

Details for d2rtrd_

PDB Entry: 2rtr, 1.62 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 4.0, space group i222

PDB Compounds: (D:) streptavidin

SCOP Domain Sequences for d2rtrd_:

Sequence; same for both SEQRES and ATOM records:

>d2rtrd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d2rtrd_:

• d2rtrd_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtrd_ appears in SCOP 1.71
  
• d2rtrd_ appears in SCOP 1.75
  
• d2rtrd_ appears in the current release, SCOPe 2.08