![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Coccidioides immitis [TaxId:246410] [272847] (1 PDB entry) |
![]() | Domain d5b8ib_: 5b8i B: [272848] Other proteins in same PDB: d5b8ia_, d5b8ic_ automated match to d2ehba_ complexed with ca, edo, fe, fk5, mes, zn |
PDB Entry: 5b8i (more details), 1.85 Å
SCOPe Domain Sequences for d5b8ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8ib_ a.39.1.0 (B:) automated matches {Coccidioides immitis [TaxId: 246410]} mssqvlndivsgsnfdheevdrlwkrfmkldrdksgtierdeflslpqvssnplstrmia ifdedgggdvdfqefvsglsafsskgnkeeklrfafkvydidrdgfisngelfivlkmmv gsnlkdmqlqqivdktimeadldgdgrisfeeftrmventdvsmsmtldqf
Timeline for d5b8ib_: