Lineage for d5b8ia_ (5b8i A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206306Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2206307Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2206385Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 protein domains)
  6. 2206487Protein automated matches [190344] (4 species)
    not a true protein
  7. 2206488Species Coccidioides immitis [TaxId:246410] [272845] (1 PDB entry)
  8. 2206489Domain d5b8ia_: 5b8i A: [272846]
    Other proteins in same PDB: d5b8ib_, d5b8ic_
    automated match to d1m63a_
    complexed with ca, edo, fe, fk5, mes, zn

Details for d5b8ia_

PDB Entry: 5b8i (more details), 1.85 Å

PDB Description: crystal structure of calcineurin a and calcineurin b in complex with fkbp12 and fk506 from coccidioides immitis rs
PDB Compounds: (A:) Serine/threonine-protein phosphatase

SCOPe Domain Sequences for d5b8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8ia_ d.159.1.3 (A:) automated matches {Coccidioides immitis [TaxId: 246410]}
lervckevqapafhtptneqfwspvdpskpnlaflkqhfyregrltedqalwiiqagtel
lraepnllemdapitvcgdvhgqyydlmklfevggdpaetrylflgdyvdrgyfsiecvl
ylwalkiwypntlwllrgnhecrhltdyftfkleckhkysekvydacmesfcalplaaim
nkqflcihgglspelhtlediksidrfreppthglmcdilwadpledfgtektgeyfvhn
nvrgcsfffsypaacafleknnllsiiraheaqdagyrmyqktrttgfpsvmtifsapny
ldvynnkaavlkyennvmnirqfnctphpywlpnfmdvftwslpfvgekitdmliailn

SCOPe Domain Coordinates for d5b8ia_:

Click to download the PDB-style file with coordinates for d5b8ia_.
(The format of our PDB-style files is described here.)

Timeline for d5b8ia_: