SCOPe 2.05: Domain d5a25b_: 5a25 B:

Lineage for d5a25b_ (5a25 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (4 PDB entries)

8. Domain d5a25b_: 5a25 B: [272840]
   automated match to d1v9ic_
   complexed with bog, gol, na, zn

Details for d5a25b_

PDB Entry: 5a25, 1.9 Å

PDB Description: rational engineering of a mesophilic carbonic anhydrase to an extreme halotolerant biocatalyst

PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5a25b_:

Sequence; same for both SEQRES and ATOM records:

>d5a25b_ b.74.1.1 (B:) Carbonic anhydrase {Cow (Bos taurus), isozyme II [TaxId: 9913]}
hhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvnn
ghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlvh
wntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpgs
llpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellmla
nwrpaqplknrqvrgfpk

Timeline for d5a25b_:

• d5a25b_ is new in SCOPe 2.05-stable
  
• d5a25b_ appears in SCOPe 2.06
  
• d5a25b_ appears in the current release, SCOPe 2.08