SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4zo4b1 (4zo4 B:2-199)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (125 species)
    not a true protein
  7. 2114040Species Campylobacter jejuni [TaxId:192222] [189931] (2 PDB entries)
  8. 2114043Domain d4zo4b1: 4zo4 B:2-199 [272836]
    Other proteins in same PDB: d4zo4a2, d4zo4b2, d4zo4c2, d4zo4d2
    automated match to d4ttra_
    complexed with bme

Details for d4zo4b1

PDB Entry: 4zo4 (more details), 2.57 Å

PDB Description: dephospho-coa kinase from campylobacter jejuni.
PDB Compounds: (B:) dephospho-coa kinase

SCOPe Domain Sequences for d4zo4b1:

Sequence, based on SEQRES records: (download)

>d4zo4b1 c.37.1.0 (B:2-199) automated matches {Campylobacter jejuni [TaxId: 192222]}
knaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknllk
kekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplffes
gayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntns
yadfrqecvkviqeiskg

Sequence, based on observed residues (ATOM records): (download)

>d4zo4b1 c.37.1.0 (B:2-199) automated matches {Campylobacter jejuni [TaxId: 192222]}
knaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknllk
kekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplfenl
gkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntnsyadfrq
ecvkviqeiskg

SCOPe Domain Coordinates for d4zo4b1:

Click to download the PDB-style file with coordinates for d4zo4b1.
(The format of our PDB-style files is described here.)

Timeline for d4zo4b1:

  • d4zo4b1 first appeared in SCOPe 2.05, called d4zo4b_