Lineage for d4znda1 (4znd A:1-435)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957306Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2957307Protein automated matches [190878] (15 species)
    not a true protein
  7. 2957333Species Coxiella burnetii [TaxId:227377] [189961] (4 PDB entries)
  8. 2957346Domain d4znda1: 4znd A:1-435 [272834]
    Other proteins in same PDB: d4znda2
    automated match to d3slhd_
    complexed with bme, k, po4, s3p

Details for d4znda1

PDB Entry: 4znd (more details), 2.55 Å

PDB Description: 2.55 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate, phosphate, and potassium
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOPe Domain Sequences for d4znda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4znda1 d.68.2.0 (A:1-435) automated matches {Coxiella burnetii [TaxId: 227377]}
mdyqtipsqglsgeicvpgdksishravllaaiaegqtqvdgflmgadnlamvsalqqmg
asiqviedenilvvegvgmtglqappealdcgnsgtairllsgllagqpfntvltgdssl
qrrpmkriidpltlmgakidstgnvpplkiygnprltgihyqlpmasaqvksclllagly
argktcitepapsrdhterllkhfhytlqkdkqsicvsgggklkandisipgdissaaff
ivaatitpgsairlcrvgvnptrlgvinllkmmgadievthytekneeptaditvrharl
kgidippdqvpltidefpvlliaaavaqgktvlrdaaelrvketdriaamvdglqklgia
aeslpdgviiqggtleggevnsyddhriamafavagtlakgpvrirncdnvktsfpnfve
lanevgmnvkgvrgr

SCOPe Domain Coordinates for d4znda1:

Click to download the PDB-style file with coordinates for d4znda1.
(The format of our PDB-style files is described here.)

Timeline for d4znda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4znda2