Lineage for d4zk4a1 (4zk4 A:1-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (4 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries)
  8. 2408652Domain d4zk4a1: 4zk4 A:1-210 [272833]
    Other proteins in same PDB: d4zk4a2, d4zk4b2, d4zk4c2, d4zk4d2, d4zk4e2
    automated match to d3sioc_
    complexed with mg, pg4, so4, tii

Details for d4zk4a1

PDB Entry: 4zk4 (more details), 1.9 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with 7-(5-isopropoxy- pyridin-3-yl)-1-methyl-1,7-diaza-spiro[4.4]nonane
PDB Compounds: (A:) soluble acetylcholine receptor, neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d4zk4a1:

Sequence, based on SEQRES records: (download)

>d4zk4a1 b.96.1.0 (A:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qykhdikyncceeiypdvvlvvkfrerrag

Sequence, based on observed residues (ATOM records): (download)

>d4zk4a1 b.96.1.0 (A:1-210) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykh
dikyncceeiypdvvlvvkfrerrag

SCOPe Domain Coordinates for d4zk4a1:

Click to download the PDB-style file with coordinates for d4zk4a1.
(The format of our PDB-style files is described here.)

Timeline for d4zk4a1: