Lineage for d4zk1h_ (4zk1 H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810768Protein automated matches [190922] (3 species)
    not a true protein
  7. 1810769Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (19 PDB entries)
  8. 1810777Domain d4zk1h_: 4zk1 H: [272825]
    automated match to d4alxa_
    complexed with 4p7, po4

Details for d4zk1h_

PDB Entry: 4zk1 (more details), 1.75 Å

PDB Description: crystal structure of lymnaea stagnalis acetylcholine-binding protein (lsachbp) in complex with 3-pyrrolylmethylene anabaseine
PDB Compounds: (H:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zk1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zk1h_ b.96.1.1 (H:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
kddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwq
qttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlym
psirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeil
dvtqkknsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d4zk1h_:

Click to download the PDB-style file with coordinates for d4zk1h_.
(The format of our PDB-style files is described here.)

Timeline for d4zk1h_: