Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d4zk1d1: 4zk1 D:1-204 [272822] Other proteins in same PDB: d4zk1a2, d4zk1b2, d4zk1c2, d4zk1d2, d4zk1e2, d4zk1f2, d4zk1g2, d4zk1h2, d4zk1i2, d4zk1j2 automated match to d4alxa_ complexed with 4p7, po4 |
PDB Entry: 4zk1 (more details), 1.75 Å
SCOPe Domain Sequences for d4zk1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zk1d1 b.96.1.1 (D:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkk
Timeline for d4zk1d1: