Lineage for d4zjtg1 (4zjt G:1-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2084602Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2084696Protein automated matches [190922] (2 species)
    not a true protein
  7. 2084697Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2084758Domain d4zjtg1: 4zjt G:1-210 [272811]
    Other proteins in same PDB: d4zjta2, d4zjtb2, d4zjtc2, d4zjtd2, d4zjte2, d4zjtf2, d4zjtg2, d4zjth2, d4zjti2, d4zjtj2
    automated match to d4alxa_
    complexed with 4p6, po4

Details for d4zjtg1

PDB Entry: 4zjt (more details), 1.85 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (lsachbp) in complex with 2-thiophenylmethylene anabaseine (2tab)
PDB Compounds: (G:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zjtg1:

Sequence, based on SEQRES records: (download)

>d4zjtg1 b.96.1.1 (G:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrseil

Sequence, based on observed residues (ATOM records): (download)

>d4zjtg1 b.96.1.1 (G:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpnsddseyfsqysrfeildvtqkknsv
tysccpeayedvevslnfrkkgrseil

SCOPe Domain Coordinates for d4zjtg1:

Click to download the PDB-style file with coordinates for d4zjtg1.
(The format of our PDB-style files is described here.)

Timeline for d4zjtg1: