SCOPe 2.06: Domain d4ypda1: 4ypd A:2-277

Lineage for d4ypda1 (4ypd A:2-277)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Death-associated protein kinase, Dap [75560] (1 species)
   CaMK group; CAMKI subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75561] (26 PDB entries)
   Uniprot P53355 2-285

8. Domain d4ypda1: 4ypd A:2-277 [272809]
   Other proteins in same PDB: d4ypda2
   automated match to d1jksa_
   complexed with cl, dkg, so4

Details for d4ypda1

PDB Entry: 4ypd, 1.4 Å

PDB Description: crystal structure of dapk1 catalytic domain in complex with the hinge binding fragment 4-methylpyridazine

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d4ypda1:

Sequence; same for both SEQRES and ATOM records:

>d4ypda1 d.144.1.7 (A:2-277) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

Timeline for d4ypda1:

• d4ypda1 first appeared in SCOPe 2.05, called d4ypda_
  
• d4ypda1 appears in SCOPe 2.07
  
• d4ypda1 appears in the current release, SCOPe 2.08