SCOPe 2.08: Domain d4zjtd1: 4zjt D:1-206

Lineage for d4zjtd1 (4zjt D:1-206)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)

8. Domain d4zjtd1: 4zjt D:1-206 [272805]
   Other proteins in same PDB: d4zjta2, d4zjtb2, d4zjtc2, d4zjtd2, d4zjte2, d4zjtf2, d4zjtg2, d4zjth2, d4zjti2, d4zjtj2
   automated match to d4alxa_
   complexed with 4p6, po4

Details for d4zjtd1

PDB Entry: 4zjt, 1.85 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (lsachbp) in complex with 2-thiophenylmethylene anabaseine (2tab)

PDB Compounds: (D:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zjtd1:

Sequence; same for both SEQRES and ATOM records:

>d4zjtd1 b.96.1.1 (D:1-206) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgr

Timeline for d4zjtd1:

• d4zjtd1 first appeared in SCOPe 2.05, called d4zjtd_
  
• d4zjtd1 appears in SCOPe 2.07