SCOPe 2.05: Domain d4zcja_: 4zcj A:

Lineage for d4zcja_ (4zcj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (7 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)

8. Domain d4zcja_: 4zcj A: [272801]
   Other proteins in same PDB: d4zcjb_, d4zcjd_, d4zcjf_
   automated match to d3sdya_
   complexed with bma, nag; mutant

Details for d4zcja_

PDB Entry: 4zcj, 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4zcja_:

Sequence; same for both SEQRES and ATOM records:

>d4zcja_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvp

Timeline for d4zcja_:

• d4zcja_ is new in SCOPe 2.05-stable
  
• d4zcja_ is called d4zcja1 in SCOPe 2.06
  
• d4zcja_ appears in the current release, SCOPe 2.08, called d4zcja1