Lineage for d4zcjc1 (4zcj C:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040686Domain d4zcjc1: 4zcj C:11-324 [272800]
    Other proteins in same PDB: d4zcja2, d4zcjb_, d4zcjc2, d4zcjd_, d4zcje2, d4zcjf_
    automated match to d3sdya_
    complexed with bma, nag; mutant

Details for d4zcjc1

PDB Entry: 4zcj (more details), 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4zcjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcjc1 b.19.1.2 (C:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvp

SCOPe Domain Coordinates for d4zcjc1:

Click to download the PDB-style file with coordinates for d4zcjc1.
(The format of our PDB-style files is described here.)

Timeline for d4zcjc1:

  • d4zcjc1 first appeared in SCOPe 2.05, called d4zcjc_