Lineage for d1vwrb_ (1vwr B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301239Fold b.61: Streptavidin-like [50875] (5 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 301240Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 301241Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 301264Protein Streptavidin [50878] (1 species)
  7. 301265Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries)
  8. 301316Domain d1vwrb_: 1vwr B: [27280]
    complexed with nh2, pno

Details for d1vwrb_

PDB Entry: 1vwr (more details), 1.5 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 3.5, i4122 complex

SCOP Domain Sequences for d1vwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwrb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d1vwrb_:

Click to download the PDB-style file with coordinates for d1vwrb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwrb_: