Lineage for d4zcje_ (4zcj E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778474Domain d4zcje_: 4zcj E: [272799]
    Other proteins in same PDB: d4zcjb_, d4zcjd_, d4zcjf_
    automated match to d3sdya_
    complexed with bma, nag; mutant

Details for d4zcje_

PDB Entry: 4zcj (more details), 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4zcje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcje_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtlvkticddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvp

SCOPe Domain Coordinates for d4zcje_:

Click to download the PDB-style file with coordinates for d4zcje_.
(The format of our PDB-style files is described here.)

Timeline for d4zcje_:

  • d4zcje_ appears in periodic updates to SCOPe 2.05 starting on 2015-05-13
  • d4zcje_ is called d4zcje1 in SCOPe 2.06
  • d4zcje_ appears in the current release, SCOPe 2.07, called d4zcje1