Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [272795] (1 PDB entry) |
Domain d4zcjf_: 4zcj F: [272798] Other proteins in same PDB: d4zcja_, d4zcjc_, d4zcje_ automated match to d4d00d_ complexed with bma, nag; mutant |
PDB Entry: 4zcj (more details), 3 Å
SCOPe Domain Sequences for d4zcjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zcjf_ h.3.1.1 (F:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
Timeline for d4zcjf_: