Lineage for d4zcjd_ (4zcj D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591606Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (14 PDB entries)
  8. 2591647Domain d4zcjd_: 4zcj D: [272797]
    Other proteins in same PDB: d4zcja1, d4zcja2, d4zcjc1, d4zcjc2, d4zcje1, d4zcje2
    automated match to d4d00d_
    complexed with bma, nag; mutant

Details for d4zcjd_

PDB Entry: 4zcj (more details), 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4zcjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcjd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d4zcjd_:

Click to download the PDB-style file with coordinates for d4zcjd_.
(The format of our PDB-style files is described here.)

Timeline for d4zcjd_: