| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (33 species) not a true protein |
| Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [272795] (1 PDB entry) |
| Domain d4zcjb_: 4zcj B: [272796] Other proteins in same PDB: d4zcja_, d4zcjc_, d4zcje_ automated match to d4d00d_ complexed with bma, nag; mutant |
PDB Entry: 4zcj (more details), 3 Å
SCOPe Domain Sequences for d4zcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zcjb_ h.3.1.1 (B:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d4zcjb_: