SCOPe 2.05: Domain d4zcjb_: 4zcj B:

Lineage for d4zcjb_ (4zcj B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [272795] (1 PDB entry)

8. Domain d4zcjb_: 4zcj B: [272796]
   Other proteins in same PDB: d4zcja_, d4zcjc_, d4zcje_
   automated match to d4d00d_
   complexed with bma, nag; mutant

Details for d4zcjb_

PDB Entry: 4zcj, 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4zcjb_:

Sequence; same for both SEQRES and ATOM records:

>d4zcjb_ h.3.1.1 (B:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

Timeline for d4zcjb_:

• d4zcjb_ is new in SCOPe 2.05-stable
  
• d4zcjb_ appears in SCOPe 2.06
  
• d4zcjb_ appears in the current release, SCOPe 2.08