Lineage for d4zcjb_ (4zcj B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040945Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)
  8. 3041003Domain d4zcjb_: 4zcj B: [272796]
    Other proteins in same PDB: d4zcja1, d4zcja2, d4zcjc1, d4zcjc2, d4zcje1, d4zcje2
    automated match to d4d00d_
    complexed with nag; mutant

Details for d4zcjb_

PDB Entry: 4zcj (more details), 3 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha1 cys30, ha2 cys47 mutant
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4zcjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zcjb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidcingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d4zcjb_:

Click to download the PDB-style file with coordinates for d4zcjb_.
(The format of our PDB-style files is described here.)

Timeline for d4zcjb_: