Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein CDC42 [52619] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries) |
Domain d4yc7a1: 4yc7 A:0-177 [272788] Other proteins in same PDB: d4yc7a2 automated match to d1ajea_ complexed with gnp, mg |
PDB Entry: 4yc7 (more details), 2.5 Å
SCOPe Domain Sequences for d4yc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yc7a1 c.37.1.8 (A:0-177) CDC42 {Human (Homo sapiens) [TaxId: 9606]} mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale
Timeline for d4yc7a1: