SCOPe 2.06: Domain d4yc7a1: 4yc7 A:0-177

Lineage for d4yc7a1 (4yc7 A:0-177)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)

8. Domain d4yc7a1: 4yc7 A:0-177 [272788]
   Other proteins in same PDB: d4yc7a2
   automated match to d1ajea_
   complexed with gnp, mg

Details for d4yc7a1

PDB Entry: 4yc7, 2.5 Å

PDB Description: crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp

PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d4yc7a1:

Sequence; same for both SEQRES and ATOM records:

>d4yc7a1 c.37.1.8 (A:0-177) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale

Timeline for d4yc7a1:

• d4yc7a1 first appeared in SCOPe 2.05, called d4yc7a_
  
• d4yc7a1 appears in SCOPe 2.07
  
• d4yc7a1 appears in the current release, SCOPe 2.08