SCOPe 2.05: Domain d4yc7a_: 4yc7 A:

Lineage for d4yc7a_ (4yc7 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (28 PDB entries)

8. Domain d4yc7a_: 4yc7 A: [272788]
   automated match to d1ajea_
   complexed with gnp, mg

Details for d4yc7a_

PDB Entry: 4yc7, 2.5 Å

PDB Description: crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp

PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d4yc7a_:

Sequence; same for both SEQRES and ATOM records:

>d4yc7a_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
amqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdta
gqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidl
rddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaale

Timeline for d4yc7a_:

• d4yc7a_ is new in SCOPe 2.05-stable
  
• d4yc7a_ is called d4yc7a1 in SCOPe 2.06
  
• d4yc7a_ appears in the current release, SCOPe 2.08, called d4yc7a1