SCOPe 2.05: Domain d4ye1b_: 4ye1 B:

Lineage for d4ye1b_ (4ye1 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (57 PDB entries)
   Uniprot P00044

8. Domain d4ye1b_: 4ye1 B: [272787]
   automated match to d1ycca_
   complexed with gol, hem, t3y

Details for d4ye1b_

PDB Entry: 4ye1, 1.39 Å

PDB Description: a cytochrome c plus calixarene structure - alternative ligand binding mode

PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d4ye1b_:

Sequence; same for both SEQRES and ATOM records:

>d4ye1b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace

Timeline for d4ye1b_:

• d4ye1b_ is new in SCOPe 2.05-stable
  
• d4ye1b_ appears in SCOPe 2.06
  
• d4ye1b_ appears in the current release, SCOPe 2.08