SCOP 1.73: Domain d2rtcb_: 2rtc B:

Lineage for d2rtcb_ (2rtc B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d2rtcb_: 2rtc B: [27278]

Details for d2rtcb_

PDB Entry: 2rtc, 1.5 Å

PDB Description: apostreptavidin, ph 3.60, space group i222

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d2rtcb_:

Sequence; same for both SEQRES and ATOM records:

>d2rtcb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtcb_:

• d2rtcb_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtcb_ appears in SCOP 1.71
  
• d2rtcb_ appears in SCOP 1.75
  
• d2rtcb_ appears in the current release, SCOPe 2.08