Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mus musculus [TaxId:10090] [272441] (35 PDB entries) |
Domain d4xpbl2: 4xpb L:109-214 [272778] Other proteins in same PDB: d4xpbl1 automated match to d2i9la2 complexed with cl, clr, coc, n9s, na; mutant |
PDB Entry: 4xpb (more details), 3.05 Å
SCOPe Domain Sequences for d4xpbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xpbl2 b.1.1.2 (L:109-214) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d4xpbl2: