Lineage for d4xpbl2 (4xpb L:109-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1764241Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)
  8. 1764288Domain d4xpbl2: 4xpb L:109-214 [272778]
    Other proteins in same PDB: d4xpbl1
    automated match to d2i9la2
    complexed with cl, clr, coc, n9s, na; mutant

Details for d4xpbl2

PDB Entry: 4xpb (more details), 3.05 Å

PDB Description: x-ray structure of drosophila dopamine transporter with subsiteb mutations (d121g/s426m) bound to cocaine
PDB Compounds: (L:) antibody fragment heavy chain-protein, 9d5-heavy chain

SCOPe Domain Sequences for d4xpbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xpbl2 b.1.1.2 (L:109-214) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4xpbl2:

Click to download the PDB-style file with coordinates for d4xpbl2.
(The format of our PDB-style files is described here.)

Timeline for d4xpbl2: