SCOPe 2.05: Domain d4xnul1: 4xnu L:1-108

Lineage for d4xnul1 (4xnu L:1-108)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4xnul1: 4xnu L:1-108 [272774]
   Other proteins in same PDB: d4xnul2
   automated match to d2i9la1
   complexed with 41u, cl, clr, na

Details for d4xnul1

PDB Entry: 4xnu, 2.98 Å

PDB Description: x-ray structure of drosophila dopamine transporter in complex with nisoxetine

PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d4xnul1:

Sequence; same for both SEQRES and ATOM records:

>d4xnul1 b.1.1.0 (L:1-108) automated matches {Mus musculus [TaxId: 10090]}
envltqspaimstspgekvtmtcrasssvgssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedaatyycqqfsgypltfgsgtklemk

Timeline for d4xnul1:

• d4xnul1 is new in SCOPe 2.05-stable
  
• d4xnul1 appears in SCOPe 2.06
  
• d4xnul1 appears in the current release, SCOPe 2.08