Lineage for d4xhjc2 (4xhj C:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (683 PDB entries)
  8. 2025362Domain d4xhjc2: 4xhj C:108-212 [272772]
    Other proteins in same PDB: d4xhjc1, d4xhjg1
    automated match to d3qpqc2
    complexed with bma, man, nag

Details for d4xhjc2

PDB Entry: 4xhj (more details), 3.16 Å

PDB Description: ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
PDB Compounds: (C:) Fab-RC light chain

SCOPe Domain Sequences for d4xhjc2:

Sequence, based on SEQRES records: (download)

>d4xhjc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records): (download)

>d4xhjc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4xhjc2:

Click to download the PDB-style file with coordinates for d4xhjc2.
(The format of our PDB-style files is described here.)

Timeline for d4xhjc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xhjc1