SCOPe 2.08: Domain d4xhjc2: 4xhj C:108-212

Lineage for d4xhjc2 (4xhj C:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4xhjc2: 4xhj C:108-212 [272772]
   Other proteins in same PDB: d4xhjc1, d4xhjg1
   automated match to d3qpqc2
   complexed with nag

Details for d4xhjc2

PDB Entry: 4xhj, 3.16 Å

PDB Description: ghgl of varicella-zoster virus in complex with human neutralizing antibodies.

PDB Compounds: (C:) Fab-RC light chain

SCOPe Domain Sequences for d4xhjc2:

Sequence, based on SEQRES records:

>d4xhjc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d4xhjc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadvyacevthqglsspvtksfnr

Timeline for d4xhjc2:

• d4xhjc2 first appeared in SCOPe 2.05
  
• d4xhjc2 appears in SCOPe 2.07