Lineage for d4xhjc1 (4xhj C:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765195Domain d4xhjc1: 4xhj C:1-107 [272770]
    Other proteins in same PDB: d4xhjc2, d4xhjg2
    automated match to d3qpqc1
    complexed with bma, man, nag

Details for d4xhjc1

PDB Entry: 4xhj (more details), 3.16 Å

PDB Description: ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
PDB Compounds: (C:) Fab-RC light chain

SCOPe Domain Sequences for d4xhjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xhjc1 b.1.1.0 (C:1-107) automated matches {Homo sapiens [TaxId: 9606]}
diqmtqspsflsasvgdrvtitcrasqgldnflawyqqkpgkapklliyaastlqrgvps
rfggsgsgteftltisslqpedfatyycqqlnsysltfgpgtkveik

SCOPe Domain Coordinates for d4xhjc1:

Click to download the PDB-style file with coordinates for d4xhjc1.
(The format of our PDB-style files is described here.)

Timeline for d4xhjc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xhjc2